PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002089m
Common NameCICLE_v10002089mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 284aa    MW: 31343.9 Da    PI: 8.2132
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002089mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.9e-332276155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Ciclev10002089m 22 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 76
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4551979IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-321977IPR009057Homeodomain-like
SuperFamilySSF466892.87E-162279IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-242277IPR006447Myb domain, plants
PfamPF002498.5E-92475IPR001005SANT/Myb domain
PfamPF143791.7E-19122167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MERSAYVSYP YENGVMMTRD PKPRLRWTAD LHDRFVDAVT KLGGPDKATP KSVLRLMGLK  60
GLTLYHLKSH LQKYRLGQQT RRQHGADQHK ENNGGSSFVN FYNGSLATSM TSSRGDEDQG  120
PISEALKCQA EVQQRLQEQL EVQERLQMRI EAQGKYLQAI LQKAQKSLSV DSSVTGNVNA  180
EAARDQLTTF NLAISNLMES MNEQDRKGNA TEFNDMIKKG NANGSSFRVQ GDCGEREGNE  240
GDNKHKVDGG STHFDLNTKG SYDFNGIAAN GIGLGPSTML SYN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432631.10.0hypothetical protein CICLE_v10002089mg
RefseqXP_006471438.10.0PREDICTED: myb family transcription factor APL isoform X3
SwissprotQ9SAK51e-52APL_ARATH; Myb family transcription factor APL
TrEMBLA0A067EUR20.0A0A067EUR2_CITSI; Uncharacterized protein
TrEMBLV4T8I90.0V4T8I9_9R
STRINGGLYMA01G01300.14e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124952530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-72G2-like family protein